Lineage for d2bv8c_ (2bv8 C:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 903785Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 903940Protein automated matches [190531] (6 species)
    not a true protein
  7. 903973Species Red algae (Gracilaria chilensis) [TaxId:2775] [187492] (1 PDB entry)
  8. 903976Domain d2bv8c_: 2bv8 C: [163174]
    automated match to d1phna_
    complexed with cyc, peb

Details for d2bv8c_

PDB Entry: 2bv8 (more details), 2.01 Å

PDB Description: the crystal structure of phycocyanin from gracilaria chilensis.
PDB Compounds: (C:) c-phycocyanin alpha subunit

SCOPe Domain Sequences for d2bv8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bv8c_ a.1.1.3 (C:) automated matches {Red algae (Gracilaria chilensis) [TaxId: 2775]}
mktpiteaiasadsqgrflsngelqsingryqratasleaarsltsnaerlisgaaqsvy
skfpyttqmqgpnyaadatgkakcardigyylrmvtyclvvgatgpmdeyliaglseinr
sfelspswyiealeyikdshalsgqaaneantyldyainals

SCOPe Domain Coordinates for d2bv8c_:

Click to download the PDB-style file with coordinates for d2bv8c_.
(The format of our PDB-style files is described here.)

Timeline for d2bv8c_: