Lineage for d2bv4b_ (2bv4 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1812045Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 1812046Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) (S)
  5. 1812156Family b.115.1.0: automated matches [191398] (1 protein)
    not a true family
  6. 1812157Protein automated matches [190521] (2 species)
    not a true protein
  7. 1812176Species Chromobacterium violaceum [TaxId:536] [187479] (2 PDB entries)
  8. 1812178Domain d2bv4b_: 2bv4 B: [163170]
    automated match to d1uqxa_
    complexed with ca, mma

Details for d2bv4b_

PDB Entry: 2bv4 (more details), 1 Å

PDB Description: 1.0a structure of chromobacterium violaceum lectin in complex with alpha-methyl-mannoside
PDB Compounds: (B:) lectin cv-iil

SCOPe Domain Sequences for d2bv4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bv4b_ b.115.1.0 (B:) automated matches {Chromobacterium violaceum [TaxId: 536]}
aqqgvftlparinfgvtvlvnsaatqhveifvdnepraafsgvgtgdnnlgtkvinsgsg
nvrvqitangrqsdlvssqlvlanklnlavvgsedgtdmdyndsivilnwplg

SCOPe Domain Coordinates for d2bv4b_:

Click to download the PDB-style file with coordinates for d2bv4b_.
(The format of our PDB-style files is described here.)

Timeline for d2bv4b_: