Class b: All beta proteins [48724] (176 folds) |
Fold b.115: Calcium-mediated lectin [82025] (1 superfamily) sandwich; 9 strands in 2 sheets; greek-key |
Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) |
Family b.115.1.0: automated matches [191398] (1 protein) not a true family |
Protein automated matches [190521] (2 species) not a true protein |
Species Chromobacterium violaceum [TaxId:536] [187479] (2 PDB entries) |
Domain d2bv4b_: 2bv4 B: [163170] automated match to d1uqxa_ complexed with ca, mma |
PDB Entry: 2bv4 (more details), 1 Å
SCOPe Domain Sequences for d2bv4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bv4b_ b.115.1.0 (B:) automated matches {Chromobacterium violaceum [TaxId: 536]} aqqgvftlparinfgvtvlvnsaatqhveifvdnepraafsgvgtgdnnlgtkvinsgsg nvrvqitangrqsdlvssqlvlanklnlavvgsedgtdmdyndsivilnwplg
Timeline for d2bv4b_: