Lineage for d1cunc1 (1cun C:7-115)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534473Fold a.7: Spectrin repeat-like [46965] (13 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 534474Superfamily a.7.1: Spectrin repeat [46966] (1 family) (S)
  5. 534475Family a.7.1.1: Spectrin repeat [46967] (3 proteins)
    this is a repeat family; one repeat unit is 1hci A:512-632 found in domain
  6. 534488Protein Spectrin alpha chain [46968] (3 species)
  7. 534489Species Chicken (Gallus gallus) [TaxId:9031] [46970] (4 PDB entries)
  8. 534496Domain d1cunc1: 1cun C:7-115 [16317]

Details for d1cunc1

PDB Entry: 1cun (more details), 2 Å

PDB Description: crystal structure of repeats 16 and 17 of chicken brain alpha spectrin

SCOP Domain Sequences for d1cunc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cunc1 a.7.1.1 (C:7-115) Spectrin alpha chain {Chicken (Gallus gallus)}
mvhqffrdmddeeswikekkllvssedygrdltgvqnlrkkhkrleaelaahepaiqsvl
dtgkklsddntigkeeiqqrlaqfvdhwkelkqlaaargqrleesleyq

SCOP Domain Coordinates for d1cunc1:

Click to download the PDB-style file with coordinates for d1cunc1.
(The format of our PDB-style files is described here.)

Timeline for d1cunc1: