Lineage for d2bv1b_ (2bv1 B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496843Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 1496844Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 1496905Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 1496906Protein automated matches [190464] (2 species)
    not a true protein
  7. 1496910Species Human (Homo sapiens) [TaxId:9606] [187381] (25 PDB entries)
  8. 1496920Domain d2bv1b_: 2bv1 B: [163168]
    automated match to d2jm5a1

Details for d2bv1b_

PDB Entry: 2bv1 (more details), 2 Å

PDB Description: regulator of g-protein signalling 1 (human)
PDB Compounds: (B:) regulator of g-protein signalling 1

SCOPe Domain Sequences for d2bv1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bv1b_ a.91.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvlsaaevmqwsqslekllanqtgqnvfgsflksefseeniefwlacedykktesdllpc
kaeeiykafvhsdaakqinidfrtrestakkikaptptcfdeaqkviytlmekdsyprfl
ksdiylnlln

SCOPe Domain Coordinates for d2bv1b_:

Click to download the PDB-style file with coordinates for d2bv1b_.
(The format of our PDB-style files is described here.)

Timeline for d2bv1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bv1a_