Lineage for d2btjd_ (2btj D:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1021948Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1021949Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1022370Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1022371Protein automated matches [190526] (7 species)
    not a true protein
  7. 1022431Species Lobophyllia hemprichii [TaxId:46758] [187486] (9 PDB entries)
  8. 1022455Domain d2btjd_: 2btj D: [163166]
    automated match to d1mova_
    complexed with iey

Details for d2btjd_

PDB Entry: 2btj (more details), 2 Å

PDB Description: Fluorescent Protein EosFP - red form
PDB Compounds: (D:) green to red photoconvertible gpf-like protein eosfp

SCOPe Domain Sequences for d2btjd_:

Sequence, based on SEQRES records: (download)

>d2btjd_ d.22.1.0 (D:) automated matches {Lobophyllia hemprichii [TaxId: 46758]}
ggaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdfrttykak
ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpd

Sequence, based on observed residues (ATOM records): (download)

>d2btjd_ d.22.1.0 (D:) automated matches {Lobophyllia hemprichii [TaxId: 46758]}
ggaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
fnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfhgv
nfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdfrttykakekg
vklpgyhfvdhcieilshdkdynkvklyehavahsglpd

SCOPe Domain Coordinates for d2btjd_:

Click to download the PDB-style file with coordinates for d2btjd_.
(The format of our PDB-style files is described here.)

Timeline for d2btjd_: