SCOPe 2.03: Domain d2btia_: 2bti A:

Lineage for d2btia_ (2bti A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.151: CsrA-like [117129] (1 superfamily)
   sandwich; 10 strands in 2 sheets; intertwined dimer (segment-swapped, 5-stranded greek-key sandwich?)

4. Superfamily b.151.1: CsrA-like [117130] (1 family)

5. Family b.151.1.1: CsrA-like [117131] (2 proteins)
   Pfam PF02599

6. Protein automated matches [190528] (1 species)
   not a true protein

7. Species Yersinia enterocolitica [TaxId:630] [187488] (1 PDB entry)

8. Domain d2btia_: 2bti A: [163161]
   automated match to d1vpza_
   complexed with act, so4

Details for d2btia_

PDB Entry: 2bti, 2 Å

PDB Description: structure-function studies of the rmsa csra post-transcriptional global regulator protein family reveals a class of rna-binding structure

PDB Compounds: (A:) carbon storage regulator homolog

SCOPe Domain Sequences for d2btia_:

Sequence; same for both SEQRES and ATOM records:

>d2btia_ b.151.1.1 (A:) automated matches {Yersinia enterocolitica [TaxId: 630]}
smliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhreeiyqriqaeksqp

Timeline for d2btia_:

• d2btia_ first appeared in SCOPe 2.01
  
• d2btia_ appears in SCOPe 2.02
  
• d2btia_ appears in SCOPe 2.04
  
• d2btia_ appears in the current release, SCOPe 2.08