Class b: All beta proteins [48724] (180 folds) |
Fold b.151: CsrA-like [117129] (1 superfamily) sandwich; 10 strands in 2 sheets; intertwined dimer (segment-swapped, 5-stranded greek-key sandwich?) |
Superfamily b.151.1: CsrA-like [117130] (2 families) |
Family b.151.1.1: CsrA-like [117131] (2 proteins) Pfam PF02599 |
Protein automated matches [190528] (4 species) not a true protein |
Species Yersinia enterocolitica [TaxId:630] [187488] (1 PDB entry) |
Domain d2btia_: 2bti A: [163161] automated match to d1vpza_ complexed with act, so4 |
PDB Entry: 2bti (more details), 2 Å
SCOPe Domain Sequences for d2btia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2btia_ b.151.1.1 (A:) automated matches {Yersinia enterocolitica [TaxId: 630]} smliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhreeiyqriqaeksqp
Timeline for d2btia_: