Lineage for d2btda_ (2btd A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736564Fold a.208: DhaL-like [101472] (1 superfamily)
    multihelical; bundle
  4. 2736565Superfamily a.208.1: DhaL-like [101473] (2 families) (S)
  5. 2736577Family a.208.1.0: automated matches [191401] (1 protein)
    not a true family
  6. 2736578Protein automated matches [190529] (2 species)
    not a true protein
  7. 2736585Species Escherichia coli [TaxId:562] [187489] (1 PDB entry)
  8. 2736586Domain d2btda_: 2btd A: [163160]
    automated match to d3cr3a1
    complexed with adp, mg

Details for d2btda_

PDB Entry: 2btd (more details), 2.6 Å

PDB Description: crystal structure of dhal from e. coli
PDB Compounds: (A:) pts-dependent dihydroxyacetone kinase

SCOPe Domain Sequences for d2btda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2btda_ a.208.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
slsrtqivnwltrcgdifsteseyltgldreigdadhglnmnrgfskvveklpaiadkdi
gfilkntgmtllssvggasgplfgtffiraaqatqarqsltleelyqmfrdgadgvisrg
kaepgdktmcdvwvpvveslrqsseqnlsvpvaleaassiaesaaqstitmqarkgrasy
lgersighqdpgatsvmfmmqmlalaake

SCOPe Domain Coordinates for d2btda_:

Click to download the PDB-style file with coordinates for d2btda_.
(The format of our PDB-style files is described here.)

Timeline for d2btda_: