![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.208: DhaL-like [101472] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.208.1: DhaL-like [101473] (2 families) ![]() |
![]() | Family a.208.1.0: automated matches [191401] (1 protein) not a true family |
![]() | Protein automated matches [190529] (2 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [187489] (1 PDB entry) |
![]() | Domain d2btda_: 2btd A: [163160] automated match to d3cr3a1 complexed with adp, mg |
PDB Entry: 2btd (more details), 2.6 Å
SCOPe Domain Sequences for d2btda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2btda_ a.208.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} slsrtqivnwltrcgdifsteseyltgldreigdadhglnmnrgfskvveklpaiadkdi gfilkntgmtllssvggasgplfgtffiraaqatqarqsltleelyqmfrdgadgvisrg kaepgdktmcdvwvpvveslrqsseqnlsvpvaleaassiaesaaqstitmqarkgrasy lgersighqdpgatsvmfmmqmlalaake
Timeline for d2btda_: