Lineage for d2bsee1 (2bse E:6-123)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2744140Domain d2bsee1: 2bse E:6-123 [163158]
    Other proteins in same PDB: d2bsea_, d2bseb_, d2bsec_, d2bsed2, d2bsee2, d2bsef2
    automated match to d1g9ea_

Details for d2bsee1

PDB Entry: 2bse (more details), 2.7 Å

PDB Description: structure of lactococcal bacteriophage p2 receptor binding protein in complex with a llama vhh domain
PDB Compounds: (E:) llama immunoglobulin

SCOPe Domain Sequences for d2bsee1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bsee1 b.1.1.1 (E:6-123) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyyadsvk
grftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvtvss

SCOPe Domain Coordinates for d2bsee1:

Click to download the PDB-style file with coordinates for d2bsee1.
(The format of our PDB-style files is described here.)

Timeline for d2bsee1: