![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
![]() | Family b.2.3.5: F17c-type adhesin [89215] (3 proteins) automatically mapped to Pfam PF09222 |
![]() | Protein automated matches [190525] (1 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [187483] (6 PDB entries) |
![]() | Domain d2bsba_: 2bsb A: [163156] automated match to d1oioa_ complexed with nag |
PDB Entry: 2bsb (more details), 2.4 Å
SCOPe Domain Sequences for d2bsba_:
Sequence, based on SEQRES records: (download)
>d2bsba_ b.2.3.5 (A:) automated matches {Escherichia coli [TaxId: 562]} avsfigstendvgpsqgsysrthamdnlpfvydtgynigyqnanvwhisggfcvgldgkv dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnyvstqgl svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndt
>d2bsba_ b.2.3.5 (A:) automated matches {Escherichia coli [TaxId: 562]} avsfigstendvgpsqgsyslpfvydtgynigyqnanvwhisggfcvgldgkvdlpvvgs ldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnyvstqglsvhvrpv ilysvqktsigsirmrpyngssagsvqttvnfslnpftlndt
Timeline for d2bsba_: