SCOPe 2.04: Domain d2bs8a_: 2bs8 A:

Lineage for d2bs8a_ (2bs8 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.5: F17c-type adhesin [89215] (3 proteins)
   automatically mapped to Pfam PF09222

6. Protein automated matches [190525] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187483] (6 PDB entries)

8. Domain d2bs8a_: 2bs8 A: [163155]
   automated match to d1oioa_
   complexed with nag

Details for d2bs8a_

PDB Entry: 2bs8, 2.25 Å

PDB Description: crystal structure of f17b-g in complex with n-acetyl-d-glucosamine

PDB Compounds: (A:) adhesin

SCOPe Domain Sequences for d2bs8a_:

Sequence; same for both SEQRES and ATOM records:

>d2bs8a_ b.2.3.5 (A:) automated matches {Escherichia coli [TaxId: 562]}
vvsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrigggfcvgldgkv
dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnylstqgl
svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndt

Timeline for d2bs8a_:

• d2bs8a_ first appeared in SCOPe 2.01
  
• d2bs8a_ appears in SCOPe 2.03
  
• d2bs8a_ appears in SCOPe 2.05
  
• d2bs8a_ appears in the current release, SCOPe 2.08