Lineage for d2bs8a_ (2bs8 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 938438Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 938566Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 938720Family b.2.3.5: F17c-type adhesin [89215] (3 proteins)
  6. 938735Protein automated matches [190525] (1 species)
    not a true protein
  7. 938736Species Escherichia coli [TaxId:562] [187483] (5 PDB entries)
  8. 938741Domain d2bs8a_: 2bs8 A: [163155]
    automated match to d1oioa_
    complexed with nag

Details for d2bs8a_

PDB Entry: 2bs8 (more details), 2.25 Å

PDB Description: crystal structure of f17b-g in complex with n-acetyl-d-glucosamine
PDB Compounds: (A:) adhesin

SCOPe Domain Sequences for d2bs8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bs8a_ b.2.3.5 (A:) automated matches {Escherichia coli [TaxId: 562]}
vvsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrigggfcvgldgkv
dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnylstqgl
svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndt

SCOPe Domain Coordinates for d2bs8a_:

Click to download the PDB-style file with coordinates for d2bs8a_.
(The format of our PDB-style files is described here.)

Timeline for d2bs8a_: