Lineage for d2bs71_ (2bs7 1:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040518Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2040818Family b.2.3.5: F17c-type adhesin [89215] (3 proteins)
    automatically mapped to Pfam PF09222
  6. 2040833Protein automated matches [190525] (1 species)
    not a true protein
  7. 2040834Species Escherichia coli [TaxId:562] [187483] (6 PDB entries)
  8. 2040836Domain d2bs71_: 2bs7 1: [163154]
    automated match to d1oioa_
    complexed with cbs

Details for d2bs71_

PDB Entry: 2bs7 (more details), 2.1 Å

PDB Description: crystal structure of f17b-g in complex with chitobiose
PDB Compounds: (1:) f17bg lectin

SCOPe Domain Sequences for d2bs71_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bs71_ b.2.3.5 (1:) automated matches {Escherichia coli [TaxId: 562]}
vvsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrigggfcvgldgkv
dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwsvgnylstqgl
svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndt

SCOPe Domain Coordinates for d2bs71_:

Click to download the PDB-style file with coordinates for d2bs71_.
(The format of our PDB-style files is described here.)

Timeline for d2bs71_: