Class b: All beta proteins [48724] (177 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.5: F17c-type adhesin [89215] (3 proteins) automatically mapped to Pfam PF09222 |
Protein automated matches [190525] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [187483] (6 PDB entries) |
Domain d2bs71_: 2bs7 1: [163154] automated match to d1oioa_ complexed with cbs |
PDB Entry: 2bs7 (more details), 2.1 Å
SCOPe Domain Sequences for d2bs71_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bs71_ b.2.3.5 (1:) automated matches {Escherichia coli [TaxId: 562]} vvsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrigggfcvgldgkv dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwsvgnylstqgl svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndt
Timeline for d2bs71_: