Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) 6-standed beta-sheet followed with 2 helices; meander |
Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) |
Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins) |
Protein automated matches [190495] (3 species) not a true protein |
Species Bacteriophage MS2 [TaxId:12022] [187484] (2 PDB entries) |
Domain d2bs1b_: 2bs1 B: [163152] automated match to d1u1ya_ protein/RNA complex; mutant |
PDB Entry: 2bs1 (more details), 2.8 Å
SCOPe Domain Sequences for d2bs1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bs1b_ d.85.1.1 (B:) automated matches {Bacteriophage MS2 [TaxId: 12022]} asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti kvevpkvatqtvggvelpvaawrsylamkltipifatnsdcelivkamqgllkdgnpips aiaansgiy
Timeline for d2bs1b_: