Lineage for d2bs1b_ (2bs1 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962441Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 2962442Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 2962443Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 2962611Protein automated matches [190495] (3 species)
    not a true protein
  7. 2962612Species Bacteriophage MS2 [TaxId:12022] [187484] (2 PDB entries)
  8. 2962614Domain d2bs1b_: 2bs1 B: [163152]
    automated match to d1u1ya_
    protein/RNA complex; mutant

Details for d2bs1b_

PDB Entry: 2bs1 (more details), 2.8 Å

PDB Description: MS2 (N87AE89K mutant) - Qbeta RNA hairpin complex
PDB Compounds: (B:) ms2 coat protein

SCOPe Domain Sequences for d2bs1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bs1b_ d.85.1.1 (B:) automated matches {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylamkltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOPe Domain Coordinates for d2bs1b_:

Click to download the PDB-style file with coordinates for d2bs1b_.
(The format of our PDB-style files is described here.)

Timeline for d2bs1b_: