| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.7: 14-3-3 protein [48445] (1 family) ![]() automatically mapped to Pfam PF00244 |
| Family a.118.7.1: 14-3-3 protein [48446] (5 proteins) |
| Protein automated matches [190238] (10 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187008] (56 PDB entries) |
| Domain d2br9a_: 2br9 A: [163150] automated match to d1o9ca_ |
PDB Entry: 2br9 (more details), 1.75 Å
SCOPe Domain Sequences for d2br9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2br9a_ a.118.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dredlvyqaklaeqaerydemvesmkkvagmdveltveernllsvayknvigarraswri
issieqkeenkggedklkmireyrqmvetelkliccdildvldkhlipaantgeskvfyy
kmkgdyhrylaefatgndrkeaaenslvaykaasdiamtelppthpirlglalnfsvfyy
eilnspdracrlakaafddaiaeldtlseesykdstlimqllrdnltlwt
Timeline for d2br9a_: