Lineage for d2bqxa_ (2bqx A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 951105Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 951201Family b.40.5.0: automated matches [191399] (1 protein)
    not a true family
  6. 951202Protein automated matches [190523] (2 species)
    not a true protein
  7. 951210Species Helicobacter pylori [TaxId:85962] [187481] (3 PDB entries)
  8. 951211Domain d2bqxa_: 2bqx A: [163148]
    automated match to d1qeza_

Details for d2bqxa_

PDB Entry: 2bqx (more details), 1.9 Å

PDB Description: inorganic pyrophosphatase from the pathogenic bacterium helicobacter pylori-kinetic and structural properties
PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d2bqxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bqxa_ b.40.5.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
evshdadslcvvieiskhsnikyeldkesgalmvdrvlygaqnypanygfvpntlgsdgd
pvdalvlsdvafqagsvvkarlvgvlnmedesgmdeklialpidkidpthsyvkdiddls
khtldkikhffetykdlepnkwvkvkgfenkesaikvlekaikayq

SCOPe Domain Coordinates for d2bqxa_:

Click to download the PDB-style file with coordinates for d2bqxa_.
(The format of our PDB-style files is described here.)

Timeline for d2bqxa_: