Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) |
Family b.40.5.0: automated matches [191399] (1 protein) not a true family |
Protein automated matches [190523] (2 species) not a true protein |
Species Helicobacter pylori [TaxId:85962] [187481] (3 PDB entries) |
Domain d2bqxa_: 2bqx A: [163148] automated match to d1qeza_ |
PDB Entry: 2bqx (more details), 1.9 Å
SCOPe Domain Sequences for d2bqxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bqxa_ b.40.5.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]} evshdadslcvvieiskhsnikyeldkesgalmvdrvlygaqnypanygfvpntlgsdgd pvdalvlsdvafqagsvvkarlvgvlnmedesgmdeklialpidkidpthsyvkdiddls khtldkikhffetykdlepnkwvkvkgfenkesaikvlekaikayq
Timeline for d2bqxa_: