SCOPe 2.04: Domain d2bpea_: 2bpe A:

Lineage for d2bpea_ (2bpe A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (12 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187331] (17 PDB entries)

8. Domain d2bpea_: 2bpe A: [163140]
   automated match to d1ypqa1
   complexed with ca, cl, pg4

Details for d2bpea_

PDB Entry: 2bpe, 2.25 Å

PDB Description: structure of murine dectin-1

PDB Compounds: (A:) dectin-1

SCOPe Domain Sequences for d2bpea_:

Sequence; same for both SEQRES and ATOM records:

>d2bpea_ d.169.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qsclpnwimhgkscylfsfsgnswygskrhcsqlgahllkidnskefefiesqtsshrin
afwiglsrnqsegpwfwedgsaffpnsfqvrnavpqesllhncvwihgsevynqicntss
ysicekelk

Timeline for d2bpea_:

• d2bpea_ first appeared in SCOPe 2.01
  
• d2bpea_ appears in SCOPe 2.03
  
• d2bpea_ appears in SCOPe 2.05
  
• d2bpea_ appears in the current release, SCOPe 2.08, called d2bpea1