![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.1: Spectrin repeat [46966] (1 family) ![]() |
![]() | Family a.7.1.1: Spectrin repeat [46967] (3 proteins) this is a repeat family; one repeat unit is 1hci A:512-632 found in domain |
![]() | Protein Spectrin alpha chain [46968] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [46970] (4 PDB entries) Uniprot P07751 1662-1981 |
![]() | Domain d1cuna2: 1cun A:116-219 [16314] repeats 16 and 17 |
PDB Entry: 1cun (more details), 2 Å
SCOP Domain Sequences for d1cuna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} qfvanveeeeawinekmtlvasedygdtlaaiqgllkkheafetdftvhkdrvndvcang edlikknnhhvenitakmkglkgkvsdlekaaaqrkakldensa
Timeline for d1cuna2:
![]() Domains from other chains: (mouse over for more information) d1cunb1, d1cunb2, d1cunc1, d1cunc2 |