Lineage for d1cuna2 (1cun A:116-219)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 763928Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 763929Superfamily a.7.1: Spectrin repeat [46966] (1 family) (S)
  5. 763930Family a.7.1.1: Spectrin repeat [46967] (3 proteins)
    this is a repeat family; one repeat unit is 1hci A:512-632 found in domain
  6. 763943Protein Spectrin alpha chain [46968] (3 species)
  7. 763944Species Chicken (Gallus gallus) [TaxId:9031] [46970] (4 PDB entries)
    Uniprot P07751 1662-1981
  8. 763948Domain d1cuna2: 1cun A:116-219 [16314]
    repeats 16 and 17

Details for d1cuna2

PDB Entry: 1cun (more details), 2 Å

PDB Description: crystal structure of repeats 16 and 17 of chicken brain alpha spectrin
PDB Compounds: (A:) protein (alpha spectrin)

SCOP Domain Sequences for d1cuna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]}
qfvanveeeeawinekmtlvasedygdtlaaiqgllkkheafetdftvhkdrvndvcang
edlikknnhhvenitakmkglkgkvsdlekaaaqrkakldensa

SCOP Domain Coordinates for d1cuna2:

Click to download the PDB-style file with coordinates for d1cuna2.
(The format of our PDB-style files is described here.)

Timeline for d1cuna2: