Lineage for d1cuna2 (1cun A:116-219)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1840Fold a.7: Spectrin repeat-like [46965] (6 superfamilies)
  4. 1841Superfamily a.7.1: Spectrin repeat [46966] (1 family) (S)
  5. 1842Family a.7.1.1: Spectrin repeat [46967] (2 proteins)
    this is a repeat family; one repeat unit is 1hci A:512-632 found in domain
  6. 1847Protein Spectrin [46968] (2 species)
  7. Species Chicken (Gallus gallus) [TaxId:9031] [46970] (2 PDB entries)
  8. Domain d1cuna2: 1cun A:116-219 [16314]

Details for d1cuna2

PDB Entry: 1cun (more details), 2 Å

PDB Description: crystal structure of repeats 16 and 17 of chicken brain alpha spectrin

SCOP Domain Sequences for d1cuna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cuna2 a.7.1.1 (A:116-219) Spectrin {Chicken (Gallus gallus)}
qfvanveeeeawinekmtlvasedygdtlaaiqgllkkheafetdftvhkdrvndvcang
edlikknnhhvenitakmkglkgkvsdlekaaaqrkakldensa

SCOP Domain Coordinates for d1cuna2 are not available.

Timeline for d1cuna2:

Domains from same chain:
(mouse over for more information)
d1cuna1
Domains from other chains:
(mouse over for more information)
d1cunb1, d1cunb2, d1cunc1, d1cunc2