Lineage for d2bn0b_ (2bn0 B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1137196Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 1137214Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 1137330Family b.77.3.0: automated matches [191397] (1 protein)
    not a true family
  6. 1137331Protein automated matches [190516] (2 species)
    not a true protein
  7. 1137334Species Musa acuminata [TaxId:4641] [187471] (6 PDB entries)
  8. 1137346Domain d2bn0b_: 2bn0 B: [163131]
    automated match to d1c3ka_
    complexed with cd, so4

Details for d2bn0b_

PDB Entry: 2bn0 (more details), 2.8 Å

PDB Description: banana lectin bound to laminaribiose
PDB Compounds: (B:) ripening-associated protein

SCOPe Domain Sequences for d2bn0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bn0b_ b.77.3.0 (B:) automated matches {Musa acuminata [TaxId: 4641]}
gaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsggtp
heivlqegeylvgmagevanyhgavvlgklgfstnkkaygpfgntggtpfslpiaagkis
gffgrggkfldaigvylep

SCOPe Domain Coordinates for d2bn0b_:

Click to download the PDB-style file with coordinates for d2bn0b_.
(The format of our PDB-style files is described here.)

Timeline for d2bn0b_: