SCOP 1.73: Domain d1cuna1: 1cun A:7-115

Lineage for d1cuna1 (1cun A:7-115)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.7: Spectrin repeat-like [46965] (15 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.1: Spectrin repeat [46966] (1 family)

5. Family a.7.1.1: Spectrin repeat [46967] (3 proteins)
   this is a repeat family; one repeat unit is 1hci A:512-632 found in domain

6. Protein Spectrin alpha chain [46968] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [46970] (4 PDB entries)

8. Domain d1cuna1: 1cun A:7-115 [16313]

Details for d1cuna1

PDB Entry: 1cun, 2 Å

PDB Description: crystal structure of repeats 16 and 17 of chicken brain alpha spectrin

PDB Compounds: (A:) protein (alpha spectrin)

SCOP Domain Sequences for d1cuna1:

Sequence; same for both SEQRES and ATOM records:

>d1cuna1 a.7.1.1 (A:7-115) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]}
mvhqffrdmddeeswikekkllvssedygrdltgvqnlrkkhkrleaelaahepaiqsvl
dtgkklsddntigkeeiqqrlaqfvdhwkelkqlaaargqrleesleyq

Timeline for d1cuna1:

• d1cuna1 first appeared (with stable ids) in SCOP 1.55
  
• d1cuna1 appears in SCOP 1.71
  
• d1cuna1 appears in SCOP 1.75
  
• d1cuna1 appears in the current release, SCOPe 2.08