Lineage for d1cuna1 (1cun A:7-115)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 278620Fold a.7: Spectrin repeat-like [46965] (8 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 278621Superfamily a.7.1: Spectrin repeat [46966] (1 family) (S)
  5. 278622Family a.7.1.1: Spectrin repeat [46967] (2 proteins)
    this is a repeat family; one repeat unit is 1hci A:512-632 found in domain
  6. 278635Protein Spectrin [46968] (2 species)
  7. 278636Species Chicken (Gallus gallus) [TaxId:9031] [46970] (2 PDB entries)
  8. 278637Domain d1cuna1: 1cun A:7-115 [16313]

Details for d1cuna1

PDB Entry: 1cun (more details), 2 Å

PDB Description: crystal structure of repeats 16 and 17 of chicken brain alpha spectrin

SCOP Domain Sequences for d1cuna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cuna1 a.7.1.1 (A:7-115) Spectrin {Chicken (Gallus gallus)}
mvhqffrdmddeeswikekkllvssedygrdltgvqnlrkkhkrleaelaahepaiqsvl
dtgkklsddntigkeeiqqrlaqfvdhwkelkqlaaargqrleesleyq

SCOP Domain Coordinates for d1cuna1:

Click to download the PDB-style file with coordinates for d1cuna1.
(The format of our PDB-style files is described here.)

Timeline for d1cuna1: