SCOP 1.61: Domain d1cuna1: 1cun A:7-115

Lineage for d1cuna1 (1cun A:7-115)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)

4. Superfamily a.7.1: Spectrin repeat [46966] (1 family)

5. Family a.7.1.1: Spectrin repeat [46967] (2 proteins)
   this is a repeat family; one repeat unit is 1hci A:512-632 found in domain

6. Protein Spectrin [46968] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [46970] (2 PDB entries)

8. Domain d1cuna1: 1cun A:7-115 [16313]

Details for d1cuna1

PDB Entry: 1cun, 2 Å

PDB Description: crystal structure of repeats 16 and 17 of chicken brain alpha spectrin

SCOP Domain Sequences for d1cuna1:

Sequence; same for both SEQRES and ATOM records:

>d1cuna1 a.7.1.1 (A:7-115) Spectrin {Chicken (Gallus gallus)}
mvhqffrdmddeeswikekkllvssedygrdltgvqnlrkkhkrleaelaahepaiqsvl
dtgkklsddntigkeeiqqrlaqfvdhwkelkqlaaargqrleesleyq

Timeline for d1cuna1:

• d1cuna1 first appeared (with stable ids) in SCOP 1.55
  
• d1cuna1 appears in SCOP 1.59
  
• d1cuna1 appears in SCOP 1.63
  
• d1cuna1 appears in the current release, SCOPe 2.08