SCOPe 2.01: Domain d2bmyb_: 2bmy B:

Lineage for d2bmyb_ (2bmy B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (2 families)

5. Family b.77.3.0: automated matches [191397] (1 protein)
   not a true family

6. Protein automated matches [190516] (1 species)
   not a true protein

7. Species Musa acuminata [TaxId:4641] [187471] (6 PDB entries)

8. Domain d2bmyb_: 2bmy B: [163127]
   automated match to d1c3ka_
   complexed with cd, so4

Details for d2bmyb_

PDB Entry: 2bmy, 2.5 Å

PDB Description: Banana Lectin

PDB Compounds: (B:) ripening-associated protein

SCOPe Domain Sequences for d2bmyb_:

Sequence; same for both SEQRES and ATOM records:

>d2bmyb_ b.77.3.0 (B:) automated matches {Musa acuminata [TaxId: 4641]}
gaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsggtp
heivlqegeylvgmagevanyhgavvlgklgfstnkkaygpfgntggtpfslpiaagkis
gffgrggkfldaigvylep

Timeline for d2bmyb_:

• d2bmyb_ is new in SCOPe 2.01-stable
  
• d2bmyb_ appears in SCOPe 2.02
  
• d2bmyb_ appears in the current release, SCOPe 2.08