![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) ![]() |
![]() | Family b.77.3.0: automated matches [191397] (1 protein) not a true family |
![]() | Protein automated matches [190516] (4 species) not a true protein |
![]() | Species Musa acuminata [TaxId:4641] [187471] (10 PDB entries) |
![]() | Domain d2bmya_: 2bmy A: [163126] automated match to d1c3ka_ complexed with cd, so4 |
PDB Entry: 2bmy (more details), 2.5 Å
SCOPe Domain Sequences for d2bmya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bmya_ b.77.3.0 (A:) automated matches {Musa acuminata [TaxId: 4641]} mngaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsgg tpheivlqegeylvgmagevanyhgavvlgklgfstnkkaygpfgntggtpfslpiaagk isgffgrggkfldaigvylep
Timeline for d2bmya_: