Lineage for d2bmva_ (2bmv A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856358Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 2856472Protein automated matches [190443] (6 species)
    not a true protein
  7. 2856495Species Helicobacter pylori [TaxId:210] [187348] (2 PDB entries)
  8. 2856496Domain d2bmva_: 2bmv A: [163125]
    automated match to d1fuea_
    complexed with ben, cl

Details for d2bmva_

PDB Entry: 2bmv (more details), 2.11 Å

PDB Description: apoflavodoxin from helicobacter pylori
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d2bmva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmva_ c.23.5.1 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
gkigiffgtdsgnaeaiaekiskaignaevvdvakaskeqfnsftkvilvaptagagdlq
tdwedflgtleasdfanktiglvglgdqdtysetfaegifhiyekakagkvvgqtstdgy
hfeaskaveggkfvglvidednqddltderiskwveqvkgsfa

SCOPe Domain Coordinates for d2bmva_:

Click to download the PDB-style file with coordinates for d2bmva_.
(The format of our PDB-style files is described here.)

Timeline for d2bmva_: