SCOPe 2.05: Domain d2blaa_: 2bla A:

Lineage for d2blaa_ (2bla A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein automated matches [190514] (8 species)
   not a true protein

7. Species Plasmodium vivax [TaxId:5855] [187469] (4 PDB entries)

8. Domain d2blaa_: 2bla A: [163122]
   automated match to d1j3ja_
   complexed with cp6, mes, ndp; mutant

Details for d2blaa_

PDB Entry: 2bla, 2.5 Å

PDB Description: sp21 double mutant p. vivax dihydrofolate reductase in complex with pyrimethamine

PDB Compounds: (A:) dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d2blaa_:

Sequence, based on SEQRES records:

>d2blaa_ c.71.1.1 (A:) automated matches {Plasmodium vivax [TaxId: 5855]}
enlsdvfdiyaicacckvaptsegtknepfsprtfrglgnkgtlpwkcnsvdmkyfrsvt
tyvdeskyeklkwkrerylrmeasqgggdntsggdnthggdnadklqnvvvmgrsnwesi
pkqykplpnrinvvlsktltkedvkekvfiidsiddlllllkklkyykcfiiggaqvyre
clsrnlikqiyftringaypcdvffpefdesefrvtsvsevynskgttldflvyskv

Sequence, based on observed residues (ATOM records):

>d2blaa_ c.71.1.1 (A:) automated matches {Plasmodium vivax [TaxId: 5855]}
enlsdvfdiyaicacckvaptsegtknepfsprtfrglgnkgtlpwkcnsvdmkyfrsvt
tyvdeskyeklkwkrerylrmnadklqnvvvmgrsnwesipkqykplpnrinvvlsktlt
kedvkekvfiidsiddlllllkklkyykcfiiggaqvyreclsrnlikqiyftringayp
cdvffpefdesefrvtsvsevynskgttldflvyskv

Timeline for d2blaa_:

• d2blaa_ first appeared in SCOPe 2.01
  
• d2blaa_ appears in SCOPe 2.04
  
• d2blaa_ appears in SCOPe 2.06
  
• d2blaa_ appears in the current release, SCOPe 2.08