Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
Protein automated matches [190513] (10 species) not a true protein |
Species Slime mold (Physarum polycephalum) [TaxId:5791] [187468] (1 PDB entry) |
Domain d2bl0c_: 2bl0 C: [163120] automated match to d1rfja_ complexed with ca |
PDB Entry: 2bl0 (more details), 1.75 Å
SCOPe Domain Sequences for d2bl0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bl0c_ a.39.1.0 (C:) automated matches {Slime mold (Physarum polycephalum) [TaxId: 5791]} gddqvsefkeafelfdsertgfitkeglqtvlkqfgvrvepaafnemfneadatgngkiq fpeflsmmgrrmkqttsedilrqafrtfdpegtgyipkaalqdallnlgdrlkphefaef lgitetekgqirydnfintmft
Timeline for d2bl0c_: