Lineage for d2bl0c_ (2bl0 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711591Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2711592Protein automated matches [190513] (36 species)
    not a true protein
  7. 2711812Species Slime mold (Physarum polycephalum) [TaxId:5791] [187468] (1 PDB entry)
  8. 2711813Domain d2bl0c_: 2bl0 C: [163120]
    automated match to d1rfja_
    complexed with ca

Details for d2bl0c_

PDB Entry: 2bl0 (more details), 1.75 Å

PDB Description: physarum polycephalum myosin ii regulatory domain
PDB Compounds: (C:) myosin regulatory light chain

SCOPe Domain Sequences for d2bl0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bl0c_ a.39.1.0 (C:) automated matches {Slime mold (Physarum polycephalum) [TaxId: 5791]}
gddqvsefkeafelfdsertgfitkeglqtvlkqfgvrvepaafnemfneadatgngkiq
fpeflsmmgrrmkqttsedilrqafrtfdpegtgyipkaalqdallnlgdrlkphefaef
lgitetekgqirydnfintmft

SCOPe Domain Coordinates for d2bl0c_:

Click to download the PDB-style file with coordinates for d2bl0c_.
(The format of our PDB-style files is described here.)

Timeline for d2bl0c_: