Lineage for d2spcb_ (2spc B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534473Fold a.7: Spectrin repeat-like [46965] (13 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 534474Superfamily a.7.1: Spectrin repeat [46966] (1 family) (S)
  5. 534475Family a.7.1.1: Spectrin repeat [46967] (3 proteins)
  6. 534488Protein Spectrin alpha chain [46968] (3 species)
  7. 534505Species Fruit fly (Drosophila sp.) [46969] (1 PDB entry)
  8. 534507Domain d2spcb_: 2spc B: [16312]
    the crystal structure is an intertwined dimer

Details for d2spcb_

PDB Entry: 2spc (more details), 1.8 Å

PDB Description: crystal structure of the repetitive segments of spectrin

SCOP Domain Sequences for d2spcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2spcb_ a.7.1.1 (B:) Spectrin alpha chain {Fruit fly (Drosophila sp.)}
qnldlqlymrdcelaeswmsareaflnadddanaggnvealikkhedfdkaingheqkia
alqtvadqliaqnhyasnlvdekrkqvlerwrhlkegliekrsrlgd

SCOP Domain Coordinates for d2spcb_:

Click to download the PDB-style file with coordinates for d2spcb_.
(The format of our PDB-style files is described here.)

Timeline for d2spcb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2spca_