SCOP 1.61: Domain d2spcb_: 2spc B:

Lineage for d2spcb_ (2spc B:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)

4. Superfamily a.7.1: Spectrin repeat [46966] (1 family)

5. Family a.7.1.1: Spectrin repeat [46967] (2 proteins)
   this is a repeat family; one repeat unit is 1hci A:512-632 found in domain

6. Protein Spectrin [46968] (2 species)

7. Species Fruit fly (Drosophila sp.) [46969] (1 PDB entry)

8. Domain d2spcb_: 2spc B: [16312]

Details for d2spcb_

PDB Entry: 2spc, 1.8 Å

PDB Description: crystal structure of the repetitive segments of spectrin

SCOP Domain Sequences for d2spcb_:

Sequence; same for both SEQRES and ATOM records:

>d2spcb_ a.7.1.1 (B:) Spectrin {Fruit fly (Drosophila sp.)}
qnldlqlymrdcelaeswmsareaflnadddanaggnvealikkhedfdkaingheqkia
alqtvadqliaqnhyasnlvdekrkqvlerwrhlkegliekrsrlgd

Timeline for d2spcb_:

• d2spcb_ first appeared (with stable ids) in SCOP 1.55
  
• d2spcb_ appears in SCOP 1.59
  
• d2spcb_ appears in SCOP 1.63
  
• d2spcb_ appears in the current release, SCOPe 2.08