![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.1: Spectrin repeat [46966] (2 families) ![]() |
![]() | Family a.7.1.1: Spectrin repeat [46967] (3 proteins) this is a repeat family; one repeat unit is 1hci A:512-632 found in domain |
![]() | Protein Spectrin alpha chain [46968] (3 species) |
![]() | Species Drosophila sp. [TaxId:7242] [46969] (1 PDB entry) |
![]() | Domain d2spcb_: 2spc B: [16312] the crystal structure is an intertwined dimer missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 2spc (more details), 1.8 Å
SCOPe Domain Sequences for d2spcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2spcb_ a.7.1.1 (B:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} qnldlqlymrdcelaeswmsareaflnadddanaggnvealikkhedfdkaingheqkia alqtvadqliaqnhyasnlvdekrkqvlerwrhlkegliekrsrlgd
Timeline for d2spcb_: