SCOPe 2.06: Domain d2bkmb_: 2bkm B:

Lineage for d2bkmb_ (2bkm B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
   lack the first helix (A)

6. Protein automated matches [190322] (4 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [187467] (1 PDB entry)

8. Domain d2bkmb_: 2bkm B: [163115]
   automated match to d1ux8a_
   complexed with act, hem, oxy

Details for d2bkmb_

PDB Entry: 2bkm, 1.5 Å

PDB Description: crystal structure of the truncated hemoglobin from geobacillus stearothermophilus

PDB Compounds: (B:) truncated hemoglobin from geobacillus stearothermophilus

SCOPe Domain Sequences for d2bkmb_:

Sequence; same for both SEQRES and ATOM records:

>d2bkmb_ a.1.1.1 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
eqwqtlyeaiggeetvaklveafyrrvaahpdlrpifpddltetahkqkqfltqylggpp
lytaehghpmlrarhlrfeitpkraeawlacmraamdeiglsgpareqfyhrlvltahhm
vntpdhld

Timeline for d2bkmb_:

• d2bkmb_ first appeared in SCOPe 2.01
  
• d2bkmb_ appears in SCOPe 2.05
  
• d2bkmb_ appears in SCOPe 2.07
  
• d2bkmb_ appears in the current release, SCOPe 2.08