Lineage for d2bkkc_ (2bkk C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1042230Family d.144.1.6: APH phosphotransferases [64411] (5 proteins)
  6. 1042255Protein Type IIIa 3',5"-aminoglycoside phosphotransferase [64412] (1 species)
  7. 1042256Species Enterococcus faecalis [TaxId:1351] [64413] (8 PDB entries)
  8. 1042263Domain d2bkkc_: 2bkk C: [163113]
    automated match to d1j7la_
    complexed with adp, mg

Details for d2bkkc_

PDB Entry: 2bkk (more details), 2.15 Å

PDB Description: crystal structure of aminoglycoside phosphotransferase aph (3')-iiia in complex with the inhibitor ar_3a
PDB Compounds: (C:) Aminoglycoside 3'-phosphotransferase

SCOPe Domain Sequences for d2bkkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkkc_ d.144.1.6 (C:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]}
kmrispelkkliekyrsvkdtegmspakvyklvgenenlylkmtdsrykgttydverekd
mmlwlegklpvpkvlhferhdgwsnllmseadgvlcseeyedeqspekiielyaecirlf
hsidisdcpytnsldsrlaeldyllnndladvdsenweedtpfkdprelydflktekpee
elvfshgdlgdsnifvkdgkvsgfidlgrsgradkwydiafcvrsiredigeeqyvelff
dllgikpdwekikyyilldelf

SCOPe Domain Coordinates for d2bkkc_:

Click to download the PDB-style file with coordinates for d2bkkc_.
(The format of our PDB-style files is described here.)

Timeline for d2bkkc_: