SCOPe 2.08: Domain d2bkkc_: 2bkk C:

Lineage for d2bkkc_ (2bkk C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.6: APH phosphotransferases [64411] (5 proteins)

6. Protein Type IIIa 3',5'-aminoglycoside phosphotransferase [64412] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [64413] (10 PDB entries)

8. Domain d2bkkc_: 2bkk C: [163113]
   automated match to d1j7la_
   complexed with adp, mg

Details for d2bkkc_

PDB Entry: 2bkk, 2.15 Å

PDB Description: crystal structure of aminoglycoside phosphotransferase aph (3')-iiia in complex with the inhibitor ar_3a

PDB Compounds: (C:) Aminoglycoside 3'-phosphotransferase

SCOPe Domain Sequences for d2bkkc_:

Sequence; same for both SEQRES and ATOM records:

>d2bkkc_ d.144.1.6 (C:) Type IIIa 3',5'-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]}
kmrispelkkliekyrsvkdtegmspakvyklvgenenlylkmtdsrykgttydverekd
mmlwlegklpvpkvlhferhdgwsnllmseadgvlcseeyedeqspekiielyaecirlf
hsidisdcpytnsldsrlaeldyllnndladvdsenweedtpfkdprelydflktekpee
elvfshgdlgdsnifvkdgkvsgfidlgrsgradkwydiafcvrsiredigeeqyvelff
dllgikpdwekikyyilldelf

Timeline for d2bkkc_:

• d2bkkc_ first appeared in SCOPe 2.01
  
• d2bkkc_ appears in SCOPe 2.07