SCOPe 2.08: Domain d2spca_: 2spc A:

Lineage for d2spca_ (2spc A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.1: Spectrin repeat [46966] (2 families)

5. Family a.7.1.1: Spectrin repeat [46967] (3 proteins)
   this is a repeat family; one repeat unit is 1hci A:512-632 found in domain

6. Protein Spectrin alpha chain [46968] (3 species)

7. Species Drosophila sp. [TaxId:7242] [46969] (1 PDB entry)

8. Domain d2spca_: 2spc A: [16311]
   the crystal structure is an intertwined dimer
   missing some secondary structures that made up less than one-third of the common domain

Details for d2spca_

PDB Entry: 2spc, 1.8 Å

PDB Description: crystal structure of the repetitive segments of spectrin

PDB Compounds: (A:) spectrin

SCOPe Domain Sequences for d2spca_:

Sequence; same for both SEQRES and ATOM records:

>d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]}
qnldlqlymrdcelaeswmsareaflnadddanaggnvealikkhedfdkaingheqkia
alqtvadqliaqnhyasnlvdekrkqvlerwrhlkegliekrsrlgd

Timeline for d2spca_:

• d2spca_ first appeared (with stable ids) in SCOP 1.55
  
• d2spca_ appears in SCOPe 2.07