Lineage for d2bjkb_ (2bjk B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2140673Family c.82.1.1: ALDH-like [53721] (6 protein domains)
  6. 2140987Protein automated matches [190401] (5 species)
    not a true protein
  7. 2141045Species Thermus thermophilus HB8 [TaxId:300852] [187273] (15 PDB entries)
  8. 2141047Domain d2bjkb_: 2bjk B: [163109]
    automated match to d1uzba_
    complexed with cl, flc, mpd, mrd, nad

Details for d2bjkb_

PDB Entry: 2bjk (more details), 1.4 Å

PDB Description: crystal analysis of 1-pyrroline-5-carboxylate dehydrogenase from thermus with bound nad and citrate.
PDB Compounds: (B:) 1-pyrroline-5-carboxylate dehydrogenase

SCOPe Domain Sequences for d2bjkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bjkb_ c.82.1.1 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mtvepfrnepietfqteearramrealrrvreefgrhyplyiggewvdtkermvslnpsa
psevvgttakagkaeaeaaleaawkafktwkdwpqedrsrlllkaaalmrrrkreleatl
vyevgknwveasadvaeaidfieyyaraalryrypavevvpypgednesfyvplgagvvi
apwnfpvaiftgmivgpvavgntviakpaedavvvgakvfeifheagfppgvvnflpgvg
eevgaylvehprirfinftgslevglkiyeaagrlapgqtwfkrayvetggkdaiivdet
adfdlaaegvvvsaygfqgqkcsaasrliltqgayepvlervlkraerlsvgpaeenpdl
gpvvsaeqerkvlsyieigknegqlvlggkrlegegyfiaptvftevppkariaqeeifg
pvlsvirvkdfaealevandtpygltggvysrkrehlewarrefhvgnlyfnrkitgalv
gvqpfggfklsgtnaktgaldylrlflemkavaerf

SCOPe Domain Coordinates for d2bjkb_:

Click to download the PDB-style file with coordinates for d2bjkb_.
(The format of our PDB-style files is described here.)

Timeline for d2bjkb_: