SCOPe 2.05: Domain d2bjhc_: 2bjh C:

Lineage for d2bjhc_ (2bjh C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.17: Fungal lipases [53558] (5 proteins)

6. Protein automated matches [190510] (4 species)
   not a true protein

7. Species Aspergillus niger [TaxId:5061] [187463] (1 PDB entry)

8. Domain d2bjhc_: 2bjh C: [163105]
   automated match to d1uswa_
   complexed with fer, nag, ndg

Details for d2bjhc_

PDB Entry: 2bjh, 2.54 Å

PDB Description: crystal structure of s133a anfaea-ferulic acid complex

PDB Compounds: (C:) feruloyl esterase a

SCOPe Domain Sequences for d2bjhc_:

Sequence; same for both SEQRES and ATOM records:

>d2bjhc_ c.69.1.17 (C:) automated matches {Aspergillus niger [TaxId: 5061]}
astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske
iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas
qypdyaltvtghalgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss
pettqyfrvthsndgipnlppadegyahggveywsvdpysaqntfvctgdevqcceaqgg
qgvndahttyfgmtsgactw

Timeline for d2bjhc_:

• d2bjhc_ first appeared in SCOPe 2.01
  
• d2bjhc_ appears in SCOPe 2.04
  
• d2bjhc_ appears in SCOPe 2.06
  
• d2bjhc_ appears in the current release, SCOPe 2.08