Lineage for d2bjhb_ (2bjh B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900758Family c.69.1.17: Fungal lipases [53558] (5 proteins)
  6. 2900909Protein automated matches [190510] (9 species)
    not a true protein
  7. 2900910Species Aspergillus niger [TaxId:5061] [187463] (1 PDB entry)
  8. 2900912Domain d2bjhb_: 2bjh B: [163104]
    automated match to d1uswa_
    complexed with fer, nag, ndg

Details for d2bjhb_

PDB Entry: 2bjh (more details), 2.54 Å

PDB Description: crystal structure of s133a anfaea-ferulic acid complex
PDB Compounds: (B:) feruloyl esterase a

SCOPe Domain Sequences for d2bjhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bjhb_ c.69.1.17 (B:) automated matches {Aspergillus niger [TaxId: 5061]}
astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske
iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas
qypdyaltvtghalgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss
pettqyfrvthsndgipnlppadegyahggveywsvdpysaqntfvctgdevqcceaqgg
qgvndahttyfgmtsgactw

SCOPe Domain Coordinates for d2bjhb_:

Click to download the PDB-style file with coordinates for d2bjhb_.
(The format of our PDB-style files is described here.)

Timeline for d2bjhb_: