Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.17: Fungal lipases [53558] (5 proteins) |
Protein automated matches [190510] (9 species) not a true protein |
Species Aspergillus niger [TaxId:5061] [187463] (1 PDB entry) |
Domain d2bjhb_: 2bjh B: [163104] automated match to d1uswa_ complexed with fer, nag, ndg |
PDB Entry: 2bjh (more details), 2.54 Å
SCOPe Domain Sequences for d2bjhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bjhb_ c.69.1.17 (B:) automated matches {Aspergillus niger [TaxId: 5061]} astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas qypdyaltvtghalgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss pettqyfrvthsndgipnlppadegyahggveywsvdpysaqntfvctgdevqcceaqgg qgvndahttyfgmtsgactw
Timeline for d2bjhb_: