Lineage for d2bjgb_ (2bjg B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2602131Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2602132Protein automated matches [190509] (19 species)
    not a true protein
  7. 2602564Species Clostridium perfringens [TaxId:1502] [188628] (5 PDB entries)
  8. 2602568Domain d2bjgb_: 2bjg B: [163102]
    automated match to d3pvaa_
    complexed with edo

Details for d2bjgb_

PDB Entry: 2bjg (more details), 2.1 Å

PDB Description: crystal structure of conjugated bile acid hydrolase from clostridium perfringens in complex with reaction products taurine and deoxycholate
PDB Compounds: (B:) choloylglycine hydrolase

SCOPe Domain Sequences for d2bjgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bjgb_ d.153.1.0 (B:) automated matches {Clostridium perfringens [TaxId: 1502]}
ctglaletkdglhlfgrnmdieysfnqsiifiprnfkcvnksnkkelttkyavlgmgtif
ddyptfadgmnekglgcaglnfpvyvsyskediegktnipvynfllwvlanfssveevke
alknanivdipisenipnttlhwmisditgksivveqtkeklnvfdnnigvltnsptfdw
hvanlnqyvglrynqvpefklgdqsltalgqgtglvglpgdftpasrfirvaflrdamik
ndkdsidlieffhilnnvamvrgstrtveeksdltqytscmclekgiyyyntyennqina
idmnkenldgneiktykynktlsinhvn

SCOPe Domain Coordinates for d2bjgb_:

Click to download the PDB-style file with coordinates for d2bjgb_.
(The format of our PDB-style files is described here.)

Timeline for d2bjgb_: