SCOPe 2.02: Domain d2bjga_: 2bjg A:

Lineage for d2bjga_ (2bjg A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (4 species)
   not a true protein

7. Species Clostridium perfringens [TaxId:1502] [188628] (5 PDB entries)

8. Domain d2bjga_: 2bjg A: [163101]
   automated match to d3pvaa_
   complexed with edo

Details for d2bjga_

PDB Entry: 2bjg, 2.1 Å

PDB Description: crystal structure of conjugated bile acid hydrolase from clostridium perfringens in complex with reaction products taurine and deoxycholate

PDB Compounds: (A:) choloylglycine hydrolase

SCOPe Domain Sequences for d2bjga_:

Sequence; same for both SEQRES and ATOM records:

>d2bjga_ d.153.1.0 (A:) automated matches {Clostridium perfringens [TaxId: 1502]}
ctglaletkdglhlfgrnmdieysfnqsiifiprnfkcvnksnkkelttkyavlgmgtif
ddyptfadgmnekglgcaglnfpvyvsyskediegktnipvynfllwvlanfssveevke
alknanivdipisenipnttlhwmisditgksivveqtkeklnvfdnnigvltnsptfdw
hvanlnqyvglrynqvpefklgdqsltalgqgtglvglpgdftpasrfirvaflrdamik
ndkdsidlieffhilnnvamvrgstrtveeksdltqytscmclekgiyyyntyennqina
idmnkenldgneiktykynktlsinhvn

Timeline for d2bjga_:

• d2bjga_ first appeared in SCOPe 2.01
  
• d2bjga_ appears in SCOPe 2.03
  
• d2bjga_ appears in the current release, SCOPe 2.08