Lineage for d2bjeg_ (2bje G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953323Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) (S)
  5. 2953403Family d.58.10.0: automated matches [191394] (1 protein)
    not a true family
  6. 2953404Protein automated matches [190511] (8 species)
    not a true protein
  7. 2953416Species Sulfolobus solfataricus [TaxId:2287] [187465] (8 PDB entries)
  8. 2953425Domain d2bjeg_: 2bje G: [163099]
    automated match to d1ulra_
    complexed with cl, so4

Details for d2bjeg_

PDB Entry: 2bje (more details), 1.9 Å

PDB Description: acylphosphatase from sulfolobus solfataricus. monclinic p21 space group
PDB Compounds: (G:) acylphosphatase

SCOPe Domain Sequences for d2bjeg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bjeg_ d.58.10.0 (G:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mlkrmyarvyglvqgvgfrkfvqihairlgikgyaknlpdgsvevvaegyeealskller
ikqgppaaevekvdysfseykgefedfety

SCOPe Domain Coordinates for d2bjeg_:

Click to download the PDB-style file with coordinates for d2bjeg_.
(The format of our PDB-style files is described here.)

Timeline for d2bjeg_: