Lineage for d2bjec_ (2bje C:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1206080Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) (S)
  5. 1206146Family d.58.10.0: automated matches [191394] (1 protein)
    not a true family
  6. 1206147Protein automated matches [190511] (4 species)
    not a true protein
  7. 1206150Species Sulfolobus solfataricus [TaxId:2287] [187465] (2 PDB entries)
  8. 1206154Domain d2bjec_: 2bje C: [163097]
    automated match to d1ulra_
    complexed with cl, so4

Details for d2bjec_

PDB Entry: 2bje (more details), 1.9 Å

PDB Description: acylphosphatase from sulfolobus solfataricus. monclinic p21 space group
PDB Compounds: (C:) acylphosphatase

SCOPe Domain Sequences for d2bjec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bjec_ d.58.10.0 (C:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mlkrmyarvyglvqgvgfrkfvqihairlgikgyaknlpdgsvevvaegyeealskller
ikqgppaaevekvdysfseykgefedfety

SCOPe Domain Coordinates for d2bjec_:

Click to download the PDB-style file with coordinates for d2bjec_.
(The format of our PDB-style files is described here.)

Timeline for d2bjec_: