![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) ![]() |
![]() | Family d.58.10.0: automated matches [191394] (1 protein) not a true family |
![]() | Protein automated matches [190511] (8 species) not a true protein |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [187465] (8 PDB entries) |
![]() | Domain d2bjec_: 2bje C: [163097] automated match to d1ulra_ complexed with cl, so4 |
PDB Entry: 2bje (more details), 1.9 Å
SCOPe Domain Sequences for d2bjec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bjec_ d.58.10.0 (C:) automated matches {Sulfolobus solfataricus [TaxId: 2287]} mlkrmyarvyglvqgvgfrkfvqihairlgikgyaknlpdgsvevvaegyeealskller ikqgppaaevekvdysfseykgefedfety
Timeline for d2bjec_: