| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) ![]() |
| Family d.58.10.0: automated matches [191394] (1 protein) not a true family |
| Protein automated matches [190511] (4 species) not a true protein |
| Species Sulfolobus solfataricus [TaxId:2287] [187465] (2 PDB entries) |
| Domain d2bjea_: 2bje A: [163096] automated match to d1ulra_ complexed with cl, so4 |
PDB Entry: 2bje (more details), 1.9 Å
SCOPe Domain Sequences for d2bjea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bjea_ d.58.10.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mlkrmyarvyglvqgvgfrkfvqihairlgikgyaknlpdgsvevvaegyeealskller
ikqgppaaevekvdysfseykgefedfety
Timeline for d2bjea_: