SCOPe 2.08: Domain d2bjdb_: 2bjd B:

Lineage for d2bjdb_ (2bjd B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families)

5. Family d.58.10.0: automated matches [191394] (1 protein)
   not a true family

6. Protein automated matches [190511] (8 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [187465] (8 PDB entries)

8. Domain d2bjdb_: 2bjd B: [163095]
   automated match to d1ulra_
   complexed with cd, cl, so4

Details for d2bjdb_

PDB Entry: 2bjd, 1.27 Å

PDB Description: sulfolobus solfataricus acylphosphatase. triclinic space group

PDB Compounds: (B:) acylphosphatase

SCOPe Domain Sequences for d2bjdb_:

Sequence; same for both SEQRES and ATOM records:

>d2bjdb_ d.58.10.0 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mlkrmyarvyglvqgvgfrkfvqihairlgikgyaknlpdgsvevvaegyeealskller
ikqgppaaevekvdysfseykgefedfety

Timeline for d2bjdb_:

• d2bjdb_ first appeared in SCOPe 2.01
  
• d2bjdb_ appears in SCOPe 2.07