Lineage for d1exja1 (1exj A:3-120)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45974Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
  4. 45975Superfamily a.6.1: Putative DNA-binding domain [46955] (3 families) (S)
  5. 45992Family a.6.1.3: DNA-binding domain of transcription activator BmrR [46962] (1 protein)
  6. 45993Protein DNA-binding domain of transcription activator BmrR [46963] (1 species)
  7. 45994Species Bacillus subtilis [TaxId:1423] [46964] (2 PDB entries)
  8. 45995Domain d1exja1: 1exj A:3-120 [16309]
    Other proteins in same PDB: d1exja2

Details for d1exja1

PDB Entry: 1exj (more details), 3 Å

PDB Description: crystal structure of transcription activator bmrr, from b. subtilis, bound to 21 base pair bmr operator and tpp

SCOP Domain Sequences for d1exja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exja1 a.6.1.3 (A:3-120) DNA-binding domain of transcription activator BmrR {Bacillus subtilis}
esyysigevsklanvsikalryydkidlfkpayvdpdtsyryytdsqlihldlikslkyi
gtpleemkkaqdlemeelfafyteqerqirekldflsaleqtislvkkrmkrqmeypa

SCOP Domain Coordinates for d1exja1:

Click to download the PDB-style file with coordinates for d1exja1.
(The format of our PDB-style files is described here.)

Timeline for d1exja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1exja2