SCOPe 2.07: Domain d2bhwa_: 2bhw A:

Lineage for d2bhwa_ (2bhw A:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
   membrane all-alpha fold; three transmembrane helices

4. Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families)
   duplication: contains two structural repeats

5. Family f.43.1.1: Chlorophyll a-b binding protein [103512] (2 proteins)

6. Protein automated matches [190507] (3 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [187461] (2 PDB entries)

8. Domain d2bhwa_: 2bhw A: [163089]
   automated match to d1rwtf_
   complexed with chl, cla, dgd, lhg, lux, nex, xat

Details for d2bhwa_

PDB Entry: 2bhw, 2.5 Å

PDB Description: pea light-harvesting complex ii at 2.5 angstrom resolution

PDB Compounds: (A:) chlorophyll a-b binding protein ab80

SCOPe Domain Sequences for d2bhwa_:

Sequence; same for both SEQRES and ATOM records:

>d2bhwa_ f.43.1.1 (A:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
assgspwygpdrvkylgpfsgespsyltgefpgdygwdtaglsadpetfsknrelevihs
rwamlgalgsvfpellsrngvkfgeavwfkagsqifseggldylgnpslvhaqsilaiwa
tqvilmgavegyriaggplgevvdplypggsfdplgladdpeafaelkvkelkngrlamf
smfgffvqaivtgkgplenladhladpvnnnawsyatnfvpgk

Timeline for d2bhwa_:

• d2bhwa_ first appeared in SCOPe 2.01
  
• d2bhwa_ appears in SCOPe 2.06
  
• d2bhwa_ appears in the current release, SCOPe 2.08