Lineage for d2bh4x_ (2bh4 X:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691317Protein automated matches [190113] (17 species)
    not a true protein
  7. 2691359Species Paracoccus versutus [TaxId:34007] [187457] (3 PDB entries)
  8. 2691360Domain d2bh4x_: 2bh4 X: [163082]
    automated match to d1cota_
    complexed with hec

Details for d2bh4x_

PDB Entry: 2bh4 (more details), 1.55 Å

PDB Description: x-ray structure of the m100k variant of ferric cyt c-550 from paracoccus versutus determined at 100 k.
PDB Compounds: (X:) cytochrome c-550

SCOPe Domain Sequences for d2bh4x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bh4x_ a.3.1.1 (X:) automated matches {Paracoccus versutus [TaxId: 34007]}
egdaakgekefnkckachmvqapdgtdivkggktgpnlygvvgrkiasvegfkygdgile
vaeknpdmvwseadlieyvtdpkpwlvektgdsaaktkktfklgknqadvvaflaqhspd
ag

SCOPe Domain Coordinates for d2bh4x_:

Click to download the PDB-style file with coordinates for d2bh4x_.
(The format of our PDB-style files is described here.)

Timeline for d2bh4x_: