Lineage for d2bgvx_ (2bgv X:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691317Protein automated matches [190113] (17 species)
    not a true protein
  7. 2691359Species Paracoccus versutus [TaxId:34007] [187457] (3 PDB entries)
  8. 2691361Domain d2bgvx_: 2bgv X: [163081]
    automated match to d1cota_
    complexed with hec

Details for d2bgvx_

PDB Entry: 2bgv (more details), 1.9 Å

PDB Description: x-ray structure of ferric cytochrome c-550 from paracoccus versutus
PDB Compounds: (X:) cytochrome c-550

SCOPe Domain Sequences for d2bgvx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bgvx_ a.3.1.1 (X:) automated matches {Paracoccus versutus [TaxId: 34007]}
egdaakgekefnkckachmvqapdgtdivkggktgpnlygvvgrkiasvegfkygdgile
vaeknpdmvwseadlieyvtdpkpwlvektgdsaaktkmtfklgknqadvvaflaqhspd

SCOPe Domain Coordinates for d2bgvx_:

Click to download the PDB-style file with coordinates for d2bgvx_.
(The format of our PDB-style files is described here.)

Timeline for d2bgvx_: