| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
| Protein automated matches [190113] (17 species) not a true protein |
| Species Paracoccus versutus [TaxId:34007] [187457] (3 PDB entries) |
| Domain d2bgvx_: 2bgv X: [163081] automated match to d1cota_ complexed with hec |
PDB Entry: 2bgv (more details), 1.9 Å
SCOPe Domain Sequences for d2bgvx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bgvx_ a.3.1.1 (X:) automated matches {Paracoccus versutus [TaxId: 34007]}
egdaakgekefnkckachmvqapdgtdivkggktgpnlygvvgrkiasvegfkygdgile
vaeknpdmvwseadlieyvtdpkpwlvektgdsaaktkmtfklgknqadvvaflaqhspd
Timeline for d2bgvx_: